TFIP11 Peptide - middle region
TFIP11 Peptide - middle region
Product Specifications
Product Name Alternative
NTR1, STIP, TIP39, STIP-1, Spp382, bK445C9.6
UniProt
Q9UBB9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001008697.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SERTTQSMQDFPVVDSEEEAEEEFQKELSQWRKDPSGSKKKPKYSYKTVE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
126769-HRP 100 µL
FGF12 (Fibroblast Growth Factor 12, FGF-12, Fibroblast Growth Factor Homologous Factor 1, FHF-1, Myocyte-activating Factor, FHF1, FGF12B) (HRP)
Sign In for Pricing
View Details 
orb2511176 100 µL
Uteroglobin Rabbit Polyclonal Antibody (PerCP-Cy5.5)
Sign In for Pricing
View Details A03357-4-Fluoro488 100 µg/Vial
Anti-MNT Antibody Picoband® Fluoro488 Conjugated
Sign In for Pricing
View Details 
MBS7180688 Inquire
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PUB5 Polyclonal Antibody
Sign In for Pricing
View Details