Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC24A Peptide - N-terminal region

SEC24A Peptide - N-terminal region

Product Specifications

UniProt

O95486

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001239160.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESVSQGYNFQLPGSYPHPIPAKTLNPVSGQSNYGGSQGSGQTLNRPPVAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LKB1 (STK11) (NM_000455) Human Mutant ORF Clone
RC402207 10 µg

LKB1 (STK11) (NM_000455) Human Mutant ORF Clone

Sign In for Pricing
View Details
Rabbit Polyclonal C8orf55 Antibody
NBP1-84052 0.1 mL

Rabbit Polyclonal C8orf55 Antibody

Sign In for Pricing
View Details
N, N-Di-n-butylethylenediamine
sc-269904 25 mL

N, N-Di-n-butylethylenediamine

Sign In for Pricing
View Details
Anti-Lectin, Mannose Binding 2 (LMAN2)
FY-AB46008-01 1 mL

Anti-Lectin, Mannose Binding 2 (LMAN2)

Sign In for Pricing
View Details
Anti-Lectin, Mannose Binding 2 (LMAN2)
FY-AB46008-02 100 µL

Anti-Lectin, Mannose Binding 2 (LMAN2)

Sign In for Pricing
View Details
Anti-Lectin, Mannose Binding 2 (LMAN2)
FY-AB46008-03 200 µL

Anti-Lectin, Mannose Binding 2 (LMAN2)

Sign In for Pricing
View Details