Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC24A Peptide - N-terminal region

SEC24A Peptide - N-terminal region

Product Specifications

UniProt

O95486

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001239160.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESVSQGYNFQLPGSYPHPIPAKTLNPVSGQSNYGGSQGSGQTLNRPPVAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AHCYL1 Human Over-expression Lysate
orb1367457 20 µg

AHCYL1 Human Over-expression Lysate

Sign In for Pricing
View Details
Acot6 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3631904 1.0 µg DNA

Acot6 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
SMN1 Antibody
MBS9602749-01 0.05 mL

SMN1 Antibody

Sign In for Pricing
View Details
SMN1 Antibody
MBS9602749-02 0.1 mL

SMN1 Antibody

Sign In for Pricing
View Details
SMN1 Antibody
MBS9602749-03 0.2 mL

SMN1 Antibody

Sign In for Pricing
View Details
SMN1 Antibody
MBS9602749-04 5x 0.2 mL

SMN1 Antibody

Sign In for Pricing
View Details