Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XRN2 Peptide - C-terminal region

XRN2 Peptide - C-terminal region

Product Specifications

UniProt

Q9DBR1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036047.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QNAAFQPNQYQMLGGPGGYPPRRDDHRGGRQGYPREGRKYPLPPPSGRYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant RASSF2 Antibody
RC-5246-01 50 μL

Recombinant RASSF2 Antibody

Sign In for Pricing
View Details
Recombinant RASSF2 Antibody
RC-5246-02 100 µL

Recombinant RASSF2 Antibody

Sign In for Pricing
View Details
Recombinant RASSF2 Antibody
RC-5246-03 1 mL

Recombinant RASSF2 Antibody

Sign In for Pricing
View Details
CCL3L3 (NM_001001437) Human Over-expression Lysate
LC424355 20 µg

CCL3L3 (NM_001001437) Human Over-expression Lysate

Sign In for Pricing
View Details
SEMA6C (NM_001178061) Human Over-expression Lysate
LC433594 20 µg

SEMA6C (NM_001178061) Human Over-expression Lysate

Sign In for Pricing
View Details
Luteolin- 7-O-Glucuronide
TRC-L475510-5MG 5 mg

Luteolin- 7-O-Glucuronide

Sign In for Pricing
View Details