Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

XRN2 Peptide - C-terminal region

XRN2 Peptide - C-terminal region

Product Specifications

UniProt

Q9DBR1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036047.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QNAAFQPNQYQMLGGPGGYPPRRDDHRGGRQGYPREGRKYPLPPPSGRYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

b-D-Glucosamine Pentaacetate
TRC-G515000-5G 5 g

b-D-Glucosamine Pentaacetate

Sign In for Pricing
View Details
Stfa1 Mouse Gene Knockout Kit (CRISPR)
KN516859 1 Kit

Stfa1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit
RD-FGF1-Mu-01 96 Tests

Mouse Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit
RD-FGF1-Mu-02 48 Tests

Mouse Fibroblast Growth Factor 1, Acidic (FGF1) ELISA Kit

Sign In for Pricing
View Details
Chk2 (CHEK2) Human Gene Knockout Kit (CRISPR)
KN401278 1 Kit

Chk2 (CHEK2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAGE Antibody
KC-2164-01 50 μL

RAGE Antibody

Sign In for Pricing
View Details