MAL2 Peptide - N-terminal region
MAL2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
AI461653
UniProt
Q8BI08
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_849251.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MSAGGAVPPPPNPAVSFPAPRVTLPAGPDILRTYSGAFVCLEIVLGGLVW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2131208-01 0.1 mL
APC_Cy7 Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)
Sign In for Pricing
View Details MBS2131208-02 0.2 mL
APC_Cy7 Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)
Sign In for Pricing
View Details MBS2131208-03 0.5 mL
APC_Cy7 Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)
Sign In for Pricing
View Details MBS2131208-04 1 mL
APC_Cy7 Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)
Sign In for Pricing
View Details MBS2131208-05 5 mL
APC_Cy7 Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)
Sign In for Pricing
View Details MBS2131208-06 5x 5 mL
APC_Cy7 Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)
Sign In for Pricing
View Details