Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAL2 Peptide - N-terminal region

MAL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AI461653

UniProt

Q8BI08

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_849251.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSAGGAVPPPPNPAVSFPAPRVTLPAGPDILRTYSGAFVCLEIVLGGLVW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFluor™ Violet 450 Anti-human CD200 Antibody *OX-104*
120000Z1-AAT 500 Tests

MFluor™ Violet 450 Anti-human CD200 Antibody *OX-104*

Sign In for Pricing
View Details
COX6CP4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV759242 1.0 µg DNA

COX6CP4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
EXOSC6 Rabbit Polyclonal Antibody (Biotin)
orb2124391 100 µL

EXOSC6 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Lentiviral mouse Pex5 shRNA (UAS) - Lentiviral mouse Pex5 shRNA (UAS, GFP) (100)
GTR15244329 1 Vial

Lentiviral mouse Pex5 shRNA (UAS) - Lentiviral mouse Pex5 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Human BMPR1B knockdown cell line
ABC-KD1492 1 Vial

Human BMPR1B knockdown cell line

Sign In for Pricing
View Details
CES1 (A-11) Alexa Fluor® 488
sc-365249 AF488 200 µg/mL

CES1 (A-11) Alexa Fluor® 488

Sign In for Pricing
View Details