What is the catalog number for TEN1 Peptide - N-terminal region?

The catalog number for TEN1 Peptide - N-terminal region is orb1998552.

What sizes are available for TEN1 Peptide - N-terminal region?

TEN1 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is TEN1 Peptide - N-terminal region in stock?

TEN1 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

TEN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2310004N24Rik

UniProt

Q9D7K2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_081383.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSTLRTFGRLYLYDMARSLMTLAAPQKPDQCQLLVCTNLVEPFEAHVNFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTR15146499 1 Vial

Lentiviral mouse Tbl3 shRNA (UAS) - Lentiviral mouse Tbl3 shRNA (UAS, iRFP) (100)

Sign In for Pricing

View Details

orb2910838-01 20 µg

Recombinant Arabidopsis thaliana Aquaporin NIP2-1 (NIP2-1)

Sign In for Pricing

View Details

orb2910838-02 100 µg

Recombinant Arabidopsis thaliana Aquaporin NIP2-1 (NIP2-1)

Sign In for Pricing

View Details

sc-339169 250 mg

1-tetrazolo[1,5-b]pyridazin-6-ylpiperidine-4-carboxylic acid

Sign In for Pricing

View Details

ISA72879-01 100 mg

Methyl 3-formyl-1H-indazole-4-carboxylate

Sign In for Pricing

View Details

ISA72879-02 1 g

Methyl 3-formyl-1H-indazole-4-carboxylate

Sign In for Pricing

View Details