What is the catalog number for TEN1 Peptide - N-terminal region?

The catalog number for TEN1 Peptide - N-terminal region is orb1998552.

What sizes are available for TEN1 Peptide - N-terminal region?

TEN1 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is TEN1 Peptide - N-terminal region in stock?

TEN1 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

TEN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2310004N24Rik

UniProt

Q9D7K2

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_081383.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSTLRTFGRLYLYDMARSLMTLAAPQKPDQCQLLVCTNLVEPFEAHVNFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP3-06272MFV450 0.1 mL

Rabbit Polyclonal MAGEA10 Antibody [mFluor Violet 450 SE]

Sign In for Pricing

View Details

APG01349G 0.1mg

Monoclonal Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) Antibody - Without BSA and Azide, Clone: TA99 + TYRP1/807

Sign In for Pricing

View Details

BS22165-01 100 µL

Rabbit Anti-Human IgG (H&L) - Cy5.5

Sign In for Pricing

View Details

BS22165-02 500 µL

Rabbit Anti-Human IgG (H&L) - Cy5.5

Sign In for Pricing

View Details

orb808539 2 mg

Era Antibody

Sign In for Pricing

View Details

ELI-19167m 96 Tests

Mouse Homeobox protein SIX6, Six6 ELISA KIT

Sign In for Pricing

View Details