Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCN2B Peptide - C-terminal region

SCN2B Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gm183, AI840361, 2810451E09Rik

UniProt

Q56A07

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001014761.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKMDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DERL2 Antibody - C-terminal region : Biotin (ARP65880_P050-Biotin)
ARP65880_P050-Biotin 100 µL

DERL2 Antibody - C-terminal region : Biotin (ARP65880_P050-Biotin)

Sign In for Pricing
View Details
Taf1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6662905 3x 1.0 µg

Taf1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Gpa33 (NM_001191829) Rat Untagged Clone
RN216351 10 µg

Gpa33 (NM_001191829) Rat Untagged Clone

Sign In for Pricing
View Details
Human RNF220 Protein Lysate 20ug
IHURNF220PLLY20UG 20 µg

Human RNF220 Protein Lysate 20ug

Sign In for Pricing
View Details
MEF2C siRNA (Mouse)
orb1846774-01 15 nmol

MEF2C siRNA (Mouse)

Sign In for Pricing
View Details
MEF2C siRNA (Mouse)
orb1846774-02 30 nmol

MEF2C siRNA (Mouse)

Sign In for Pricing
View Details