SCN2B Peptide - C-terminal region
SCN2B Peptide - C-terminal region
Product Specifications
Product Name Alternative
Gm183, AI840361, 2810451E09Rik
UniProt
Q56A07
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001014761.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKMDG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
500779 200 µg
HOXC8, GST-Tag, Recombinant (HOX3, HOX3A, Homeobox Protein Hox-C8) discontinued
Sign In for Pricing
View Details 
MBS7161495 Inquire
Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) YNBE Polyclonal Antibody
Sign In for Pricing
View Details RR204942L4V 200 µL
Celf1 (NM_001025421) Rat Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details