Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDHAF2 Peptide - middle region

SDHAF2 Peptide - middle region

Product Specifications

Product Name Alternative

AA407634, AW049997, 0610038F07Rik

UniProt

Q8C6I2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_079609.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARLLYESR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAM2 (Signal Transducing Adapter Molecule 2, STAM-2, Hrs-binding Protein, HBP) (MaxLight 550)
MBS6214224-01 0.1 mL

STAM2 (Signal Transducing Adapter Molecule 2, STAM-2, Hrs-binding Protein, HBP) (MaxLight 550)

Sign In for Pricing
View Details
STAM2 (Signal Transducing Adapter Molecule 2, STAM-2, Hrs-binding Protein, HBP) (MaxLight 550)
MBS6214224-02 5x 0.1 mL

STAM2 (Signal Transducing Adapter Molecule 2, STAM-2, Hrs-binding Protein, HBP) (MaxLight 550)

Sign In for Pricing
View Details
O52I1 Polyclonal Antibody
RA33737-01 50 µL

O52I1 Polyclonal Antibody

Sign In for Pricing
View Details
O52I1 Polyclonal Antibody
RA33737-02 100 µL

O52I1 Polyclonal Antibody

Sign In for Pricing
View Details
BLM Rabbit Polyclonal Antibody (PE-Cy5.5)
orb922958 100 µL

BLM Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
NIF3L1 Rabbit Polyclonal Antibody (Biotin)
orb2082133 100 µL

NIF3L1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details