Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDHAF2 Peptide - middle region

SDHAF2 Peptide - middle region

Product Specifications

Product Name Alternative

AA407634, AW049997, 0610038F07Rik

UniProt

Q8C6I2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_079609.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARLLYESR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HSPB7 Protein
CRP1688-01 10 µg

Recombinant Human HSPB7 Protein

Sign In for Pricing
View Details
Recombinant Human HSPB7 Protein
CRP1688-02 50 µg

Recombinant Human HSPB7 Protein

Sign In for Pricing
View Details
Recombinant Human HSPB7 Protein
CRP1688-03 500 µg

Recombinant Human HSPB7 Protein

Sign In for Pricing
View Details
CNPY2 antibody
70R-21486 50 μL

CNPY2 antibody

Sign In for Pricing
View Details
Fluorescent NIR 885
T86456-01 10 mg

Fluorescent NIR 885

Sign In for Pricing
View Details
Fluorescent NIR 885
T86456-02 50 mg

Fluorescent NIR 885

Sign In for Pricing
View Details