Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXYD2 Peptide - middle region

FXYD2 Peptide - middle region

Product Specifications

Product Name Alternative

Atp1g1

UniProt

Q04646

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031529.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DYETVRKGGLIFAGLAFVVGLLIILSKRFRCGGGKKHRQVNEDEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BXDC2 (BRIX1) Human Gene Knockout Kit (CRISPR)
KN401485 1 Kit

BXDC2 (BRIX1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SARS-CoV-2 Spike NTD Protein, His Tag (BA.2.75/Omicron) (MALS verified)
SPD-C522x-1mg 1 mg

SARS-CoV-2 Spike NTD Protein, His Tag (BA.2.75/Omicron) (MALS verified)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lymphoid tissue
CS645491 5x 5 µm

Frozen Tissue Sections, Lymphoid tissue

Sign In for Pricing
View Details
MAP4K1 Rabbit Polyclonal Antibody
AP06749PU-N 100 µg

MAP4K1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BHLHB3 Antibody
8C11661-AAT 50 µg

BHLHB3 Antibody

Sign In for Pricing
View Details
Recombinant NUDEL Antibody
RC-15923-01 50 μL

Recombinant NUDEL Antibody

Sign In for Pricing
View Details