Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXYD2 Peptide - middle region

FXYD2 Peptide - middle region

Product Specifications

Product Name Alternative

Atp1g1

UniProt

Q04646

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031529.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DYETVRKGGLIFAGLAFVVGLLIILSKRFRCGGGKKHRQVNEDEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM-LEHD-FMK Caspase 9 Detection Kit
FAM400-1 25 Tests

FAM-LEHD-FMK Caspase 9 Detection Kit

Sign In for Pricing
View Details
TRAFD1 Rabbit Polyclonal Antibody
TA368890 100 µL

TRAFD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZBTB43 Polyclonal Antibody
E-AB-18729-01 20 µL

ZBTB43 Polyclonal Antibody

Sign In for Pricing
View Details
ZBTB43 Polyclonal Antibody
E-AB-18729-02 60 µL

ZBTB43 Polyclonal Antibody

Sign In for Pricing
View Details
ZBTB43 Polyclonal Antibody
E-AB-18729-03 120 µL

ZBTB43 Polyclonal Antibody

Sign In for Pricing
View Details
ZBTB43 Polyclonal Antibody
E-AB-18729-04 200 µL

ZBTB43 Polyclonal Antibody

Sign In for Pricing
View Details