Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADSS Peptide - middle region

ADSS Peptide - middle region

Product Specifications

Product Name Alternative

AS, Adss2, AI314886

UniProt

P46664

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031448.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P Glycoprotein Antibody
orb621832-01 50 μL

P Glycoprotein Antibody

Sign In for Pricing
View Details
P Glycoprotein Antibody
orb621832-02 100 µL

P Glycoprotein Antibody

Sign In for Pricing
View Details
DHRSX Rabbit Polyclonal Antibody (BF405)
orb2385372 100 µL

DHRSX Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
50nm Gold NanoUrchins
GU-50-20-10 20 mL

50nm Gold NanoUrchins

Sign In for Pricing
View Details
Davunetide acetate
orb1306341-01 1 mg

Davunetide acetate

Sign In for Pricing
View Details
Davunetide acetate
orb1306341-02 2 mg

Davunetide acetate

Sign In for Pricing
View Details