Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADSS Peptide - middle region

ADSS Peptide - middle region

Product Specifications

Product Name Alternative

AS, Adss2, AI314886

UniProt

P46664

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_031448.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), 1mg/mL
BNUM2152-50 1x 50 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), 1mg/mL

Sign In for Pricing
View Details
2-Aminoimidazole Sulfate
TRC-A611706-2.5G 2.5 g

2-Aminoimidazole Sulfate

Sign In for Pricing
View Details
Recombinant Rat CD16a/FCGR3A Protein (His Tag)
PKSR030403 100 µg

Recombinant Rat CD16a/FCGR3A Protein (His Tag)

Sign In for Pricing
View Details
Polystyrene M RAM
HAM0523.5G 5 g

Polystyrene M RAM

Sign In for Pricing
View Details
Polystyrene A CHO
HA40045006.5G 5 g

Polystyrene A CHO

Sign In for Pricing
View Details
Accuris qMAX Green One-Step RT-qPCR Kit, High Rox, 100 reactions
PR2120-H-100 1 Each

Accuris qMAX Green One-Step RT-qPCR Kit, High Rox, 100 reactions

Sign In for Pricing
View Details