What is the catalog number for CATIP Peptide - N-terminal region?

The catalog number for CATIP Peptide - N-terminal region is orb1998545.

What sizes are available for CATIP Peptide - N-terminal region?

CATIP Peptide - N-terminal region is available in the following size(s): 100 µg.

Is CATIP Peptide - N-terminal region in stock?

CATIP Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

CATIP Peptide - N-terminal region

Product Specifications

Product Name Alternative

Gm216

UniProt

B9EKE5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001028517.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GETASLHHPGLEDMLLFFPETLAILSDTGEPQGELTIEVQRGKYKDDIGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LY413216 100 µg

TRIM62 (NM_018207) Human Over-expression Lysate

Sign In for Pricing

View Details

45145061 1.0 µg DNA

Sox3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing

View Details

BP2276-50ug 50 µg

Recombinant Human RPL11

Sign In for Pricing

View Details

21122-01 50 µL

IκB-α (Ab-32/36) Antibody

Sign In for Pricing

View Details

21122-02 100 µL

IκB-α (Ab-32/36) Antibody

Sign In for Pricing

View Details

G7030 96 Tests

Regulating synaptic membrane exocytosis protein 3 (RIMS3) Human ELISA Kit

Sign In for Pricing

View Details