Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CATIP Peptide - N-terminal region

CATIP Peptide - N-terminal region

Product Specifications

Product Name Alternative

Gm216

UniProt

B9EKE5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001028517.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GETASLHHPGLEDMLLFFPETLAILSDTGEPQGELTIEVQRGKYKDDIGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant M. tuberculosis Peptidoglycan-binding protein ArfA Protein, His, Yeast-10ug
QP9625-ye-10ug 10ug

Recombinant M. tuberculosis Peptidoglycan-binding protein ArfA Protein, His, Yeast-10ug

Sign In for Pricing
View Details
LILRA5 siRNA (Human)
MBS8238830-01 15 nmol

LILRA5 siRNA (Human)

Sign In for Pricing
View Details
LILRA5 siRNA (Human)
MBS8238830-02 30 nmol

LILRA5 siRNA (Human)

Sign In for Pricing
View Details
LILRA5 siRNA (Human)
MBS8238830-03 5x 30 nmol

LILRA5 siRNA (Human)

Sign In for Pricing
View Details
pAAVS1-CMV-amilRFP-EF1a-CopGFP-Puro Plasmid
PVT46281 2 µg

pAAVS1-CMV-amilRFP-EF1a-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Recombinant Mouse FBXL19 Protein, His (Fc)-Avi-tagged
FBXL19-3144M 50 µg

Recombinant Mouse FBXL19 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details