MFSD4B2 Peptide - middle region
MFSD4B2 Peptide - middle region
Product Specifications
Product Name Alternative
Naglt1b
UniProt
Q9D8I5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LFCKKHSRQKKPRASTEGARRAKYHRALLCLLFLFFFFYVGAEITYGAYV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7193179 Inquire
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) U1A Polyclonal Antibody
Sign In for Pricing
View Details 
MP07070-01 1 g
Phenyl 2,3,4,6-tetra-O-benzyl-b-D-thioglucopyranoside
Sign In for Pricing
View Details MP07070-02 2 g
Phenyl 2,3,4,6-tetra-O-benzyl-b-D-thioglucopyranoside
Sign In for Pricing
View Details MP07070-03 5 g
Phenyl 2,3,4,6-tetra-O-benzyl-b-D-thioglucopyranoside
Sign In for Pricing
View Details