Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1E1 Peptide - N-terminal region

EEF1E1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P18, AIMP3

UniProt

O43324

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001129122.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crocein Scarlet 7B
HY-D1479-01 100 mg

Crocein Scarlet 7B

Sign In for Pricing
View Details
Crocein Scarlet 7B
HY-D1479-02 1 g

Crocein Scarlet 7B

Sign In for Pricing
View Details
Plastin L Rabbit Polyclonal Antibody
APRab01400-01 20 µL

Plastin L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Plastin L Rabbit Polyclonal Antibody
APRab01400-02 50 µL

Plastin L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Plastin L Rabbit Polyclonal Antibody
APRab01400-03 100 µL

Plastin L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Plastin L Rabbit Polyclonal Antibody
APRab01400-04 200 µL

Plastin L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details