What is the catalog number for STX10 Peptide - middle region?

The catalog number for STX10 Peptide - middle region is orb1998540.

What sizes are available for STX10 Peptide - middle region?

STX10 Peptide - middle region is available in the following size(s): 100 µg.

Is STX10 Peptide - middle region in stock?

STX10 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

STX10 Peptide - middle region

Product Specifications

Product Name Alternative

SYN10, hsyn10

UniProt

O60499

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003756.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MC224145 10 µg

Atxn2 (NM_009125) Mouse Untagged Clone

Sign In for Pricing

View Details

MBS3920133 Inquire

6(Z),9(Z)-tricosadiene

Sign In for Pricing

View Details

orb575419 100 µL

MLC1 Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

117570 Roll of 10000 Label(s)

2HX-250-2-BK-4 AB Labels

Sign In for Pricing

View Details

E47R2469 100 µL

PERK Rabbit pAb

Sign In for Pricing

View Details

36070116 3x 1.0 µg

Pbk sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing

View Details