What is the catalog number for STX10 Peptide - middle region?

The catalog number for STX10 Peptide - middle region is orb1998540.

What sizes are available for STX10 Peptide - middle region?

STX10 Peptide - middle region is available in the following size(s): 100 µg.

Is STX10 Peptide - middle region in stock?

STX10 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

STX10 Peptide - middle region

Product Specifications

Product Name Alternative

SYN10, hsyn10

UniProt

O60499

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003756.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAB3803J 0.1 mL

Mouse Monoclonal CD8 Antibody (1033123) [Janelia Fluor 646]

Sign In for Pricing

View Details

GTR15134260 1 Vial

Lentiviral human MTHFD2L shRNA (UAS) - Lentiviral human MTHFD2L shRNA (UAS, iRFP) plasmid

Sign In for Pricing

View Details

PA1422-Biotin 100 µg/Vial

Anti-Galectin 1/LGALS1 Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing

View Details

sc-545289 1 Kit

CHMGCS (C-8) : m-IgG1 BP-HRP Bundle

Sign In for Pricing

View Details

FT108A0125C Box of 100

Box of 100 Technical Filter Discs 85G/M², 125 Mm

Sign In for Pricing

View Details

A68503-100 100 µL

CRYAA Polyclonal Antibody

Sign In for Pricing

View Details