Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTPS Peptide - C-terminal region

CTPS Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTPS, IMD24

UniProt

P17812

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001288166.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Ghrelin (GHRL)
TRV-0015706-01 10 µg

Recombinant Ghrelin (GHRL)

Sign In for Pricing
View Details
Recombinant Ghrelin (GHRL)
TRV-0015706-02 50 µg

Recombinant Ghrelin (GHRL)

Sign In for Pricing
View Details
Recombinant Ghrelin (GHRL)
TRV-0015706-03 100 µg

Recombinant Ghrelin (GHRL)

Sign In for Pricing
View Details
Recombinant Ghrelin (GHRL)
TRV-0015706-04 200 µg

Recombinant Ghrelin (GHRL)

Sign In for Pricing
View Details
Recombinant Ghrelin (GHRL)
TRV-0015706-05 500 µg

Recombinant Ghrelin (GHRL)

Sign In for Pricing
View Details
Recombinant Ghrelin (GHRL)
TRV-0015706-06 1 mg

Recombinant Ghrelin (GHRL)

Sign In for Pricing
View Details