Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTPS Peptide - C-terminal region

CTPS Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTPS, IMD24

UniProt

P17812

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001288166.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARFGAP1/3 (G-11)
sc-374328 200 µg/mL

ARFGAP1/3 (G-11)

Sign In for Pricing
View Details
ZMYND12 CytoSection
TS405404P5 25 Slides

ZMYND12 CytoSection

Sign In for Pricing
View Details
2- (morpholin-4-ylcarbonyl) benzoic acid
sc-274018 1 g

2- (morpholin-4-ylcarbonyl) benzoic acid

Sign In for Pricing
View Details
Rat Ankyrin repeat domain containing protein 27 (ANKRD27) ELISA kit
GTR10470251 96 Well

Rat Ankyrin repeat domain containing protein 27 (ANKRD27) ELISA kit

Sign In for Pricing
View Details
ASCL1 (Achaete-scute Complex Homolog 1 (Drosophila), ASH1, HASH1, MASH1, bHLHa46) (MaxLight 650)
243542-ML650 100 µL

ASCL1 (Achaete-scute Complex Homolog 1 (Drosophila), ASH1, HASH1, MASH1, bHLHa46) (MaxLight 650)

Sign In for Pricing
View Details
Zfp869 Protein Vector (Mouse) (pPB-C-His)
PV250402 500 ng

Zfp869 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details