GPR77 Peptide - C-terminal region
GPR77 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C5L2, GPF77, GPR77
UniProt
Q9P296
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001258678.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CLNPMLFLYFGRAQLRRSLPAACHWALRESQGQDESVDSKKSTSHDLVSE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1377737-01 0.02 mg (E-Coli)
Recombinant Synechococcus elongatus Guanylate kinase (gmk)
Sign In for Pricing
View Details MBS1377737-02 0.1 mg (E-Coli)
Recombinant Synechococcus elongatus Guanylate kinase (gmk)
Sign In for Pricing
View Details MBS1377737-03 0.02 mg (Yeast)
Recombinant Synechococcus elongatus Guanylate kinase (gmk)
Sign In for Pricing
View Details MBS1377737-04 0.1 mg (Yeast)
Recombinant Synechococcus elongatus Guanylate kinase (gmk)
Sign In for Pricing
View Details MBS1377737-05 0.02 mg (Baculovirus)
Recombinant Synechococcus elongatus Guanylate kinase (gmk)
Sign In for Pricing
View Details MBS1377737-06 0.02 mg (Mammalian-Cell)
Recombinant Synechococcus elongatus Guanylate kinase (gmk)
Sign In for Pricing
View Details