Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR77 Peptide - C-terminal region

GPR77 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C5L2, GPF77, GPR77

UniProt

Q9P296

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001258678.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CLNPMLFLYFGRAQLRRSLPAACHWALRESQGQDESVDSKKSTSHDLVSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Micrometer (Screw Gauge)
2010320/2 1 Each

Micrometer (Screw Gauge)

Sign In for Pricing
View Details
CYBC1 Antibody
orb1333421 100 µg

CYBC1 Antibody

Sign In for Pricing
View Details
LOXL1 (NM_005576) Human Tagged ORF Clone Lentiviral Particle
RC209830L4V 200 µL

LOXL1 (NM_005576) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Dgat2 Mouse Gene Knockout Kit (CRISPR)
KN304521BN 1 Kit

Dgat2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PACSIN3 Antibody - middle region
ARP77323_P050-25UL 25 µL

PACSIN3 Antibody - middle region

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), Biotin conjugate, 0.1mg/mL
BNCB1959-100 1x 100 µL

Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Marker) (KRT19/1959R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details