Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SC4MOL Peptide - N-terminal region

SC4MOL Peptide - N-terminal region

Product Specifications

Product Name Alternative

DESP4, ERG25, SC4MOL

UniProt

Q15800

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001017369.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIATWGSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFN-gamma R1/CD119 Recombinant Protein Antigen
NBP2-49406PEP 0.1 mL

IFN-gamma R1/CD119 Recombinant Protein Antigen

Sign In for Pricing
View Details
FBXL17 Polyclonal Antibody, FITC Conjugated
A67336-100 100 µL

FBXL17 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Anti-TRPC5 Rabbit pAb
GB113693-50 50 μL

Anti-TRPC5 Rabbit pAb

Sign In for Pricing
View Details
Human TMEM14B activation kit by CRISPRa
GA113136 1 Kit

Human TMEM14B activation kit by CRISPRa

Sign In for Pricing
View Details
Tmem182 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6372402 1.0 µg DNA

Tmem182 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
APC/Cyanine7 Rabbit anti-Mouse CD69 mAb
A27639-01 25 μg

APC/Cyanine7 Rabbit anti-Mouse CD69 mAb

Sign In for Pricing
View Details