RUBCNL Peptide - middle region
RUBCNL Peptide - middle region
Product Specifications
Product Name Alternative
PACER, C13orf18, KIAA0226L
UniProt
Q9H714
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001273690.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TESWSKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-7911R-BF555 100 µL
Phospho-FER (Tyr402) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
Sign In for Pricing
View Details JH917685 1 Each
(2- (2-hydroxyethoxy) -3- (1-methyl-1H-pyrazol-4-yl) phenyl) boronic acid
Sign In for Pricing
View Details 
27713154 3x 1.0 µg DNA
LRRIQ3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
Sign In for Pricing
View Details 