Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MARC1 Peptide - middle region

MARC1 Peptide - middle region

Product Specifications

Product Name Alternative

MOSC1

UniProt

Q5VT66

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_073583.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX5A Antibody, Biotin conjugated
A15476-50UG 50 µg

COX5A Antibody, Biotin conjugated

Sign In for Pricing
View Details
Prpf18 (NM_138523) Rat Untagged Clone
RN201848 10 µg

Prpf18 (NM_138523) Rat Untagged Clone

Sign In for Pricing
View Details
Anti-Cystathionase/CTH Antibody
PA1646 100 µg/Vial

Anti-Cystathionase/CTH Antibody

Sign In for Pricing
View Details
CLC Antibody, FITC conjugated
A48164-50UG 50 µg

CLC Antibody, FITC conjugated

Sign In for Pricing
View Details
CD156a Recombinant Protein
E43CP0275 500 µg

CD156a Recombinant Protein

Sign In for Pricing
View Details
SLC9A1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV690140 1.0 µg DNA

SLC9A1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details