Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CMAS Peptide - N-terminal region

CMAS Peptide - N-terminal region

Product Specifications

Product Name Alternative

CSS

UniProt

Q8NFW8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_061156.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cnot4 Mouse Gene Knockout Kit (CRISPR)
KN503562 1 Kit

Cnot4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Triethylammonium Sulfate
TRC-T797470-500MG 500 mg

Triethylammonium Sulfate

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1952), CF594 conjugate, 0.1mg/mL
BNC941952-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1952), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Barnidipine Hydrochloride
TRC-B118700-25MG 25 mg

Barnidipine Hydrochloride

Sign In for Pricing
View Details
(S)-Ru(OAc)2(BINAP)
TRC-O148455-500MG 500 mg

(S)-Ru(OAc)2(BINAP)

Sign In for Pricing
View Details
L-Carnitine Benzyl Ester Chloride
TRC-C184130-1MG 1 mg

L-Carnitine Benzyl Ester Chloride

Sign In for Pricing
View Details