Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CMAS Peptide - N-terminal region

CMAS Peptide - N-terminal region

Product Specifications

Product Name Alternative

CSS

UniProt

Q8NFW8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_061156.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MDSVEKGAATSVSNPRGRPSRGRPPKLQRNSRGGQGRGVEKPPHLAALIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clec2d Mouse Gene Knockout Kit (CRISPR)
KN503435 1 Kit

Clec2d Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Potassium Osmate(VI) Dihydrate
TRC-P698160-250MG 250 mg

Potassium Osmate(VI) Dihydrate

Sign In for Pricing
View Details
Recombinant Mouse CD172a/SIRPA Protein (His Tag)
PKSM040419 100 µg

Recombinant Mouse CD172a/SIRPA Protein (His Tag)

Sign In for Pricing
View Details
Suberoyl Bis-hydroxamic Acid
TRC-S688750-1G 1 g

Suberoyl Bis-hydroxamic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS646414 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
L-Glutamine-amide-¹⁵N
TRC-G597002-250MG 250 mg

L-Glutamine-amide-¹⁵N

Sign In for Pricing
View Details