What is the catalog number for GBP1 Peptide - middle region?

The catalog number for GBP1 Peptide - middle region is orb1998527.

What sizes are available for GBP1 Peptide - middle region?

GBP1 Peptide - middle region is available in the following size(s): 100 µg.

Is GBP1 Peptide - middle region in stock?

GBP1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

GBP1 Peptide - middle region

Product Specifications

UniProt

P32455

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002044.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVWTLRDFSLDLEADG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

46652161 1.0 µg

THEMIS AAV siRNA Pooled Vector

Sign In for Pricing

View Details

DZ41704-FITC 200 µL/Vial

Anti-Danio rerio (Zebrafish) lrrc10 Antibody FITC Conjugated

Sign In for Pricing

View Details

orb1378120 20 µg

HnRNP U (HNRNPU) Human Over-expression Lysate

Sign In for Pricing

View Details

MBS1425717-01 0.5 mg (E-Coli)

Recombinant Canis lupus ATP synthase protein 8 (MT-ATP8), partial

Sign In for Pricing

View Details

MBS1425717-02 0.05 mg (Baculovirus)

Recombinant Canis lupus ATP synthase protein 8 (MT-ATP8), partial

Sign In for Pricing

View Details

MBS1425717-03 0.5 mg (Yeast)

Recombinant Canis lupus ATP synthase protein 8 (MT-ATP8), partial

Sign In for Pricing

View Details