Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBP1 Peptide - middle region

GBP1 Peptide - middle region

Product Specifications

UniProt

P32455

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002044.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVWTLRDFSLDLEADG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKLR Polyclonal Antibody, HRP Conjugated
A63139-050 50 µL

PKLR Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Human GC-globulin, mixed type
HY-NP0238 1 Each

Human GC-globulin, mixed type

Sign In for Pricing
View Details
INCB024360 analogue
A3493-25 25 mg

INCB024360 analogue

Sign In for Pricing
View Details
USP7 Recombinant Rabbit Monoclonal Antibody
orb1816772-01 50 µL

USP7 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
USP7 Recombinant Rabbit Monoclonal Antibody
orb1816772-02 100 µL

USP7 Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Quick-16S™ Primer Set V3-V4, 400 µl
D6405-2-400 400 µL

Quick-16S™ Primer Set V3-V4, 400 µl

Sign In for Pricing
View Details