Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBP1 Peptide - middle region

GBP1 Peptide - middle region

Product Specifications

UniProt

P32455

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002044.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cav3 (NM_007617) Mouse Tagged ORF Clone
MR226246 10 µg

Cav3 (NM_007617) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Ptpn6 (NM_013545) Mouse Recombinant Protein
E45M45560M5 20 µg

Ptpn6 (NM_013545) Mouse Recombinant Protein

Sign In for Pricing
View Details
Human Herpes Simplex II Antibody IgG ELISA Kit
NR-R10047 1 Each

Human Herpes Simplex II Antibody IgG ELISA Kit

Sign In for Pricing
View Details
CNTF protein
30R-AC073 0.025 mg

CNTF protein

Sign In for Pricing
View Details
SORL1 antibody
MBS831492-01 0.1 mL

SORL1 antibody

Sign In for Pricing
View Details
SORL1 antibody
MBS831492-02 5x 0.1 mL

SORL1 antibody

Sign In for Pricing
View Details