Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GBP1 Peptide - middle region

GBP1 Peptide - middle region

Product Specifications

UniProt

P32455

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002044.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF594 conjugate, 0.1mg/mL
BNC941788-500 1x 500 µL

B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIPIN CRISPR Activation Plasmid (h2)
sc-418481-ACT-2 20 µg

TIPIN CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Anti-Milk Fat Globule 1/MFGE8 Antibody Picoband®, HRP Conjugate
PA1945-HRP 100 µg/Vial

Anti-Milk Fat Globule 1/MFGE8 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
PLA2G2D (NM_012400) Human Over-expression Lysate
LS026279 100 µg

PLA2G2D (NM_012400) Human Over-expression Lysate

Sign In for Pricing
View Details
Lbp (NM_017208) Rat Tagged Lenti ORF Clone
RR204527L4 10 µg

Lbp (NM_017208) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
β-Glc-PEG3-Acid
C52215-100MG 1 Unit

β-Glc-PEG3-Acid

Sign In for Pricing
View Details