BIRC2 Peptide - middle region
BIRC2 Peptide - middle region
Product Specifications
Product Name Alternative
API1, MIHB, HIAP2, RNF48, cIAP1, Hiap-2, c-IAP1
UniProt
Q13490
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001157.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRF
More Discoveries
Explore Other Products
Browse additional items from our catalog
D0900 100 µL
Dab1 (Disabled homolog 1 Drosophila, Scm, Scr, Scrambler, Yot, Yotari) discontinued
Sign In for Pricing
View Details 
MBS6377019-01 0.1 mL
EFHC1 (EF-hand Domain-containing Protein 1, Myoclonin-1, FLJ10466, FLJ37290) (AP)
Sign In for Pricing
View Details 
MBS6377019-02 5x 0.1 mL
EFHC1 (EF-hand Domain-containing Protein 1, Myoclonin-1, FLJ10466, FLJ37290) (AP)
Sign In for Pricing
View Details 