Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BIRC2 Peptide - middle region

BIRC2 Peptide - middle region

Product Specifications

Product Name Alternative

API1, MIHB, HIAP2, RNF48, cIAP1, Hiap-2, c-IAP1

UniProt

Q13490

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001157.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLENSLETLRF

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human phosphatidylinositol-3,4,5-trisphosphate dependent Rac exchange factor 1 (PREX-1) ELISA Kit
YP-W18547-01 48 Tests

Human phosphatidylinositol-3,4,5-trisphosphate dependent Rac exchange factor 1 (PREX-1) ELISA Kit

Sign In for Pricing
View Details
Human phosphatidylinositol-3,4,5-trisphosphate dependent Rac exchange factor 1 (PREX-1) ELISA Kit
YP-W18547-02 96 Tests

Human phosphatidylinositol-3,4,5-trisphosphate dependent Rac exchange factor 1 (PREX-1) ELISA Kit

Sign In for Pricing
View Details
CC2D1B (NM_032449) Human Recombinant Protein
TP319061M 100 µg

CC2D1B (NM_032449) Human Recombinant Protein

Sign In for Pricing
View Details
Rabbit Anti Human DHRS3 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 120UL
IRBAMLDHRS3AP58120UL 120 µL

Rabbit Anti Human DHRS3 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,IHC,ELISA) 120UL

Sign In for Pricing
View Details
Anti-Mint3/APBA3 Antibody Picoband® Fluoro550 Conjugated
A07396-2-Fluoro550 100 µg/Vial

Anti-Mint3/APBA3 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Rat Spata2 Pre-designed siRNA Set A
SI213594A 1 Each

Rat Spata2 Pre-designed siRNA Set A

Sign In for Pricing
View Details