Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF2C Peptide - middle region

KIF2C Peptide - middle region

Product Specifications

Product Name Alternative

MCAK, CT139, KNSL6

UniProt

O00139

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001284584.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RMHGKFSLVDLAGNERGADTSSADRQTRMEGAEINKSLLALKECIRALGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse SFN shRNA Plasmid
abx974565-01 150 µg

Mouse SFN shRNA Plasmid

Sign In for Pricing
View Details
Mouse SFN shRNA Plasmid
abx974565-02 300 µg

Mouse SFN shRNA Plasmid

Sign In for Pricing
View Details
hsa-miR-4654 miRNA Antagomir
MBS8317396-01 10 nmol

hsa-miR-4654 miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-4654 miRNA Antagomir
MBS8317396-02 20 nmol

hsa-miR-4654 miRNA Antagomir

Sign In for Pricing
View Details
hsa-miR-4654 miRNA Antagomir
MBS8317396-03 5x 20 nmol

hsa-miR-4654 miRNA Antagomir

Sign In for Pricing
View Details
Gzma Antibody
A24232-50UG 50 µg

Gzma Antibody

Sign In for Pricing
View Details