Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF2C Peptide - middle region

KIF2C Peptide - middle region

Product Specifications

Product Name Alternative

MCAK, CT139, KNSL6

UniProt

O00139

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001284584.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RMHGKFSLVDLAGNERGADTSSADRQTRMEGAEINKSLLALKECIRALGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Histidine Triad Nucleotide Binding Protein 2 ELISA Kit
MBS058674-01 48 Well

Sheep Histidine Triad Nucleotide Binding Protein 2 ELISA Kit

Sign In for Pricing
View Details
Sheep Histidine Triad Nucleotide Binding Protein 2 ELISA Kit
MBS058674-02 96 Well

Sheep Histidine Triad Nucleotide Binding Protein 2 ELISA Kit

Sign In for Pricing
View Details
Sheep Histidine Triad Nucleotide Binding Protein 2 ELISA Kit
MBS058674-03 5x 96 Well

Sheep Histidine Triad Nucleotide Binding Protein 2 ELISA Kit

Sign In for Pricing
View Details
Sheep Histidine Triad Nucleotide Binding Protein 2 ELISA Kit
MBS058674-04 10x 96 Well

Sheep Histidine Triad Nucleotide Binding Protein 2 ELISA Kit

Sign In for Pricing
View Details
OR2G6, NT (OR2G6, Olfactory receptor 2G6) (FITC) discontinued
039356-FITC 200 µL

OR2G6, NT (OR2G6, Olfactory receptor 2G6) (FITC) discontinued

Sign In for Pricing
View Details
Rabbit anti-c-RAF (pY341) Antibody
MBS4513266-01 0.05 mL

Rabbit anti-c-RAF (pY341) Antibody

Sign In for Pricing
View Details