Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LTK Peptide - middle region

LTK Peptide - middle region

Product Specifications

Product Name Alternative

TYK1

UniProt

P29376

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001129157.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VGLSLRATPRLILLELMSGGDMKSFLRHSRPHLGQPSPLVMRDLLQLAQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXL12 Recombinant Protein (Mouse)
RP133880 100 µg

FBXL12 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Rabbit anti-human acyl-Coenzyme A oxidase 1, palmitoyl polyclonal Antibody
MBS711347-01 0.1 mL

Rabbit anti-human acyl-Coenzyme A oxidase 1, palmitoyl polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human acyl-Coenzyme A oxidase 1, palmitoyl polyclonal Antibody
MBS711347-02 5x 0.1 mL

Rabbit anti-human acyl-Coenzyme A oxidase 1, palmitoyl polyclonal Antibody

Sign In for Pricing
View Details
Human AFG3L2 Protein Lysate 20ug
IHUAFG3L2PLLY20UG 20 µg

Human AFG3L2 Protein Lysate 20ug

Sign In for Pricing
View Details
Recombinant Human ANXA10
PEH0069-01 10 µg

Recombinant Human ANXA10

Sign In for Pricing
View Details
Recombinant Human ANXA10
PEH0069-02 50 µg

Recombinant Human ANXA10

Sign In for Pricing
View Details