Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LTK Peptide - middle region

LTK Peptide - middle region

Product Specifications

Product Name Alternative

TYK1

UniProt

P29376

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001129157.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VGLSLRATPRLILLELMSGGDMKSFLRHSRPHLGQPSPLVMRDLLQLAQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Immunoglobulin M Kappa (IgM) AssayLite™ Antibody (FITC Conjugate)
20511-05041 2x 75 µg

Mouse Immunoglobulin M Kappa (IgM) AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
Mouse anti-human TSHR mAb (2MB)
E409C30-mB100-100 100 µL

Mouse anti-human TSHR mAb (2MB)

Sign In for Pricing
View Details
Mouse Monoclonal OBFC1 Antibody (OTI2E4) [DyLight 680]
NBP2-73138FR 0.1 mL

Mouse Monoclonal OBFC1 Antibody (OTI2E4) [DyLight 680]

Sign In for Pricing
View Details
Anti-Human BAFF - Biotin
RHF910B 50 µg

Anti-Human BAFF - Biotin

Sign In for Pricing
View Details
N3-PEG-NH2, 1K
HE006005-1K-01 1 g

N3-PEG-NH2, 1K

Sign In for Pricing
View Details
N3-PEG-NH2, 1K
HE006005-1K-02 5 g

N3-PEG-NH2, 1K

Sign In for Pricing
View Details