Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYGM Peptide - middle region

PYGM Peptide - middle region

Product Specifications

UniProt

P11217

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001158188.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QMEEADDWLRYGNPWEKARPEFTLPVHFYGHVEHTSQGAKWVDTQVVLAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ELOVL6 Antibody
A06004-2 100 µg/Vial

Anti-ELOVL6 Antibody

Sign In for Pricing
View Details
C19orf21 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2374112 100 µL

C19orf21 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
(S) -2-Methylazetidine (hydrochloride)
HY-35279-01 100 mg

(S) -2-Methylazetidine (hydrochloride)

Sign In for Pricing
View Details
(S) -2-Methylazetidine (hydrochloride)
HY-35279-02 250 mg

(S) -2-Methylazetidine (hydrochloride)

Sign In for Pricing
View Details
(S) -2-Methylazetidine (hydrochloride)
HY-35279-03 500 mg

(S) -2-Methylazetidine (hydrochloride)

Sign In for Pricing
View Details
(S) -2-Methylazetidine (hydrochloride)
HY-35279-04 1 g

(S) -2-Methylazetidine (hydrochloride)

Sign In for Pricing
View Details