Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYGM Peptide - middle region

PYGM Peptide - middle region

Product Specifications

UniProt

P11217

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001158188.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QMEEADDWLRYGNPWEKARPEFTLPVHFYGHVEHTSQGAKWVDTQVVLAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cst13 Protein Vector (Rat) (pPB-C-His)
PV262106 500 ng

Cst13 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Golgi integral membrane protein 4
MBS7042816-01 0.02 mg

Golgi integral membrane protein 4

Sign In for Pricing
View Details
Golgi integral membrane protein 4
MBS7042816-02 0.1 mg

Golgi integral membrane protein 4

Sign In for Pricing
View Details
Golgi integral membrane protein 4
MBS7042816-03 5x 0.1 mg

Golgi integral membrane protein 4

Sign In for Pricing
View Details
NDUFB2 Polyclonal Antibody
E-AB-65459-01 60 µL

NDUFB2 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFB2 Polyclonal Antibody
E-AB-65459-02 120 µL

NDUFB2 Polyclonal Antibody

Sign In for Pricing
View Details