Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPG Peptide - middle region

CAPG Peptide - middle region

Product Specifications

Product Name Alternative

MCP, AFCP, HEL-S-66

UniProt

P40121

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001243068.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RDEQGACAVLAVHLNTLLGERPVQHREVQGNESDLFMSYFPRGLKYQEGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS804229 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Mad (MXD1) (NM_002357) Human Over-expression Lysate
LY400848 100 µg

Mad (MXD1) (NM_002357) Human Over-expression Lysate

Sign In for Pricing
View Details
CD5 (CD5/54/F6), CF568 conjugate, 0.1mg/mL
BNC680746-500 1x 500 µL

CD5 (CD5/54/F6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(2S,5R)-6-Hydroxy-7-oxo-1,6-diazabicyclo[3.2.1]octane-2-carboxamide
TRC-H951175-5MG 5 mg

(2S,5R)-6-Hydroxy-7-oxo-1,6-diazabicyclo[3.2.1]octane-2-carboxamide

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2990R), CF640R conjugate, 0.1mg/mL
BNC402990-500 1x 500 µL

CD63 (Late Endosomes Marker) (LAMP3/2990R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STK40 Antibody
KC-36741-01 50 μL

STK40 Antibody

Sign In for Pricing
View Details