What is the catalog number for MAGI1 Peptide - middle region?

The catalog number for MAGI1 Peptide - middle region is orb1998511.

What sizes are available for MAGI1 Peptide - middle region?

MAGI1 Peptide - middle region is available in the following size(s): 100 µg.

Is MAGI1 Peptide - middle region in stock?

MAGI1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MAGI1 Peptide - middle region

Product Specifications

Product Name Alternative

AIP3, BAP1, WWP3, AIP-3, BAP-1, BAIAP1, MAGI-1, Magi1d, TNRC19

UniProt

Q96QZ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001028229.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DM066 1 mL

Glycophorin A (GYPA) Mouse Monoclonal Antibody [Clone ID: JC159]

Sign In for Pricing

View Details

91-552 0.05 mg

HAI-2 Recombinant Protein

Sign In for Pricing

View Details

E45R30244N-100 100 µL

TLE4 Rabbit pAb

Sign In for Pricing

View Details

NB100-2755AF532 0.1 mL

Rat Monoclonal Polyoma Virus, Large T Antigen Antibody (PyLT) [Alexa Fluor 532]

Sign In for Pricing

View Details

10-1513 1 mg

Norovirus G2 antibody

Sign In for Pricing

View Details

HY-112540A-01 5 mg

Acetoacetic acid (lithium)

Sign In for Pricing

View Details