What is the catalog number for MAGI1 Peptide - middle region?

The catalog number for MAGI1 Peptide - middle region is orb1998511.

What sizes are available for MAGI1 Peptide - middle region?

MAGI1 Peptide - middle region is available in the following size(s): 100 µg.

Is MAGI1 Peptide - middle region in stock?

MAGI1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

MAGI1 Peptide - middle region

Product Specifications

Product Name Alternative

AIP3, BAP1, WWP3, AIP-3, BAP-1, BAIAP1, MAGI-1, Magi1d, TNRC19

UniProt

Q96QZ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001028229.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GWB-2EE05C 0.1 mg

SPEF1 Over-expression Lysate Product

Sign In for Pricing

View Details

orb3102876 100 µg

SRSF9 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing

View Details

15592034 100 µg

CDC123 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing

View Details

bs-5693R-PE-Cy5.5 100 µL

Phospho-RPA2 (Thr21) Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing

View Details

LV690985 1.0 µg DNA

NAPEPLD Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing

View Details

B-1265.0250 250.0mg

Fmoc-g-carboxy-Glu(OtBu)2-OH

Sign In for Pricing

View Details