Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRXN3 Peptide - C-terminal region

NRXN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C14orf60

UniProt

Q9HDB5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001098720.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NRDEGSYQVDETRNYISNSAQSNGTLMKEKQQSSKSGHKKQKNKDREYYV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Normal Temporal Lobe Lysate
450193 0.1 mg

Human Normal Temporal Lobe Lysate

Sign In for Pricing
View Details
Rabbit Monoclonal Helicobacter Pylori Antibody (HPYL/8575R) [Alexa Fluor 750]
NBP3-20849AF750 0.1 mL

Rabbit Monoclonal Helicobacter Pylori Antibody (HPYL/8575R) [Alexa Fluor 750]

Sign In for Pricing
View Details
DAP Kinase 2 (DAPK2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C8]
TA501087AM 100 µL

DAP Kinase 2 (DAPK2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C8]

Sign In for Pricing
View Details
DNA Cleanup Maxi Kit
K1369-10 each

DNA Cleanup Maxi Kit

Sign In for Pricing
View Details
Complete Medium for Rat Epidermal keratinized epithelial Cells
abx704573-01 100 mL

Complete Medium for Rat Epidermal keratinized epithelial Cells

Sign In for Pricing
View Details
Complete Medium for Rat Epidermal keratinized epithelial Cells
abx704573-02 500 mL

Complete Medium for Rat Epidermal keratinized epithelial Cells

Sign In for Pricing
View Details