Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRXN3 Peptide - C-terminal region

NRXN3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C14orf60

UniProt

Q9HDB5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001098720.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NRDEGSYQVDETRNYISNSAQSNGTLMKEKQQSSKSGHKKQKNKDREYYV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTX1 Antibody Blocking peptide
orb1444710 500 µg

DTX1 Antibody Blocking peptide

Sign In for Pricing
View Details
Mouse S100 Calcium Binding Protein A4 (S100A4) ELISA Kit
RD-S100A4-Mu-48Tests 48 Tests

Mouse S100 Calcium Binding Protein A4 (S100A4) ELISA Kit

Sign In for Pricing
View Details
SLC25A45 Protein Lysate (Human) with C-Ha Tag
44035032 100 µg

SLC25A45 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Rabbit Anti-Human TROP-2 Polyclonal Antibody
PA86901HU-01 50 µg

Rabbit Anti-Human TROP-2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human TROP-2 Polyclonal Antibody
PA86901HU-02 100 µg

Rabbit Anti-Human TROP-2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human TROP-2 Polyclonal Antibody
PA86901HU-03 500 µg

Rabbit Anti-Human TROP-2 Polyclonal Antibody

Sign In for Pricing
View Details