Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LETM1 Peptide - middle region

LETM1 Peptide - middle region

Product Specifications

UniProt

O95202

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036450.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKSLKSLKDKNKKLEEGGPVYSPPAEVVVKKSLGQRVLDELKHYYHGFRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Olfactory receptor 5AK2 (OR5AK2) ELISA kit
GTR10462428 96 Well

Guinea Pig Olfactory receptor 5AK2 (OR5AK2) ELISA kit

Sign In for Pricing
View Details
Chk2 (phospho Thr387) Rabbit Polyclonal Antibody
E28PP0624 100 µL

Chk2 (phospho Thr387) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human RPL26L1 shRNA (UAS) - Lentiviral human RPL26L1 shRNA (UAS, RFP) (25)
GTR15330302 1 Vial

Lentiviral human RPL26L1 shRNA (UAS) - Lentiviral human RPL26L1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
NRCAM Blocking Peptide (N-Term)
MBS9230578-01 0.5 mg

NRCAM Blocking Peptide (N-Term)

Sign In for Pricing
View Details
NRCAM Blocking Peptide (N-Term)
MBS9230578-02 5x 0.5 mg

NRCAM Blocking Peptide (N-Term)

Sign In for Pricing
View Details
Nrd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6845208 1.0 µg DNA

Nrd1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details